Moral = don't use the computer after a night of heavy drinking![]()
If you are new to domains and looking to buy, sell and learn about domains then you have come to the right place. DNForum is the largest domain name community on the internet and continues to grow every day. There are over 105,000 domainers on DNForum doing everything from buying domains, selling domains, learning about domains and discussing domains. Take a minute and Register.
Register Today on DNForum IT'S FREE!2 names I saw on the on hold list..
faketeethuglyteethvampirefangsfaketeethhalloweenfa lseteethtooth.com
the-peoples-medical-malpractice-law-firm-medical-malpractice.com
538k Lyrics Database Available - Only $49 - Check Here
Moral = don't use the computer after a night of heavy drinking![]()
Sigh..... these people that publicise on hold domains. Bids at NW will go through the roof now........... ;-)
Dominion.
Sorry, I won't do it again..Originally posted by Dominion
Sigh..... these people that publicise on hold domains. Bids at NW will go through the roof now........... ;-)![]()
538k Lyrics Database Available - Only $49 - Check Here
Bookmarks