It appears you have not yet registered with our community. To register please click here...

DNforum.com - Domain Sales, Domain Forum, Domain Appraisals
 
Register Now!
Register Now for FREE!
Our records show you have not yet registered to our forums. To sign up for your FREE account INSTANTLY fill out the form below!

Username: Password: Confirm Password: E-Mail: Confirm E-Mail:  
Birthday:       I agree to forum rules 

Go Back   DNForum - Domain Sales, Domain Forum, Domain Appraisals, Domain Registrars > Gold Forums > Gold Cafe
Reply
 
LinkBack Thread Tools Display Modes
Old 08-31-2003, 12:21 PM   #1 (permalink)
Platinum Lifetime Member
 
cyphix's Avatar
 
Last Online: 08-18-2008 03:38 PM
iTrader: (26)
Join Date: Jan 2003
Posts: 3,559
DNF$: 1,325
Location: Australia
Country:


weird weird weird

2 names I saw on the on hold list..

faketeethuglyteethvampirefangsfaketeethhalloweenfa lseteethtooth.com

the-peoples-medical-malpractice-law-firm-medical-malpractice.com
__________________
538k Lyrics Database Available - Only $49 - Check Here
cyphix is offline   Reply With Quote
Sponsored Links
Old 08-31-2003, 12:29 PM   #2 (permalink)
Oldbie
 
Mr Webname's Avatar
 
Name: N one
Last Online: 01-22-2007 05:03 PM
iTrader: (6)
Join Date: Jan 2003
Posts: 4,014
DNF$: 1,843
Location: USA
Country:


Moral = don't use the computer after a night of heavy drinking
Mr Webname is offline   Reply With Quote
Old 08-31-2003, 01:12 PM   #3 (permalink)
Platinum Lifetime Member
 
Last Online: 08-19-2008 06:59 AM
iTrader: (0)
Join Date: Feb 2003
Posts: 42
DNF$: 131
Location: UK


Sigh..... these people that publicise on hold domains. Bids at NW will go through the roof now........... ;-)
__________________
Dominion.
Dominion is offline   Reply With Quote
Old 08-31-2003, 01:49 PM   #4 (permalink)
Platinum Lifetime Member
 
cyphix's Avatar
 
Last Online: 08-18-2008 03:38 PM
iTrader: (26)
Join Date: Jan 2003
Posts: 3,559
DNF$: 1,325
Location: Australia
Country:


Quote:
Originally posted by Dominion
Sigh..... these people that publicise on hold domains. Bids at NW will go through the roof now........... ;-)
Sorry, I won't do it again..
__________________
538k Lyrics Database Available - Only $49 - Check Here
cyphix is offline   Reply With Quote
Reply


Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
 
Thread Tools
Display Modes

Posting Rules

Smilies are On
[IMG] code is Off
HTML code is Off
Trackbacks are On
Pingbacks are On
Refbacks are On


All times are GMT -4. The time now is 11:34 PM.
Copyright @2001-2008 DNForum.com

Learn Domains
Promote Domains
Research Domains
Buy Domains
Resell Domains
Park Domains
Sell Domains
Build Domains
Host Domains
Trademark Domains
Domain Domains
manage Domains
Appraise Domains