.com Liquidation sale @ $5 each gunrentalsnearme.com

ebook DomainGraduate.com
Visit nameliquidate.com
All dot com domain names for sale are contained within this thread.

domainmojito

New Member
Joined
Dec 21, 2017
Messages
3
Reaction score
1
Feedback: 0 / 0 / 0
Hi All,

Back with another liquidation sale. 355 Geo , EMD and Brandable domains are on sale.

Per domain 5 usd each.

All domains are .com and registered in Godaddy .

Payment via PayPal. Kindly pm and check availability of domain before posting sold

All details like Domain name , expiry date , Godaddy valuation are mentioned in the spreadsheet.

Please pm and check availability of domains before posting sold.

Here is the link to the spreadsheet:-

https://docs.google.com/spreadsheets/d/1RW25dbe2sugmtDwiGqDOBe8uB9wgYuo5vCd0ZccrL6o/edit?usp=sharing

businessformationlawyers.com
delawareohiodivorceattorney.com
detroitevictionlawyers.com
discriminationlawyernearme.com
disinfectionservicecompany.com
divorceattorneypuyallup.com
divorcelawyerbatavia.com
divorcelawyernearby.com
divorcelawyertempe.com
documenteditingservice.com
dogtransportservices.com
doorrepairsydney.com
gunrentalsnearme.com
hartfordaccidentlawyers.com
haulingservicesnearme.com
hawaiilimoservices.com
healthcareservicesprovider.com
scootersrentalnearme.com
scottsburgrentals.com
scrapremovalservices.com
seattleassaultattorney.com
seattlecopyrightlawyers.com
securitycamerasnearme.com
securityguardservicesnearme.com
securityservicenearme.com
singaporepropertyrental.com
singaporevanrental.com
hempattorneysnearme.com
hemplawyersnearme.com
holidayrentalshome.com
holidaysvacationrentals.com
homebutlerservice.com
homeclosinglawyers.com
homeloanlawyers.com
homemakeoverservices.com
homemakingservice.com
homemoversnearme.com
homerentalscolorado.com
homeshreddingservices.com
housedisinfectionservice.com
houseinspectionnearme.com
houseinsurancelawyer.com
housekeepernearme.com
housemoversnearme.com
lakewoodranchinjurylawyer.com
lansingpersonalinjurylawyers.com
laundryservicessingapore.com
lawyerforestates.com
lawyerpharmacist.com
lawyerprobono.com
lawyerscambridge.com
lawyersestate.com
lawyersexpungement.com
lawyersforfathersrights.com
leafcleaningservice.com
limoservicenapavalley.com
littlehouserentals.com
seniorlawyersnearme.com
seniorservicesnearme.com
seoserviceireland.com
sequoiacabinrental.com
seriousinjuriesattorneys.com
servicedapartmentmelbourne.com
sidewalksrepair.com
singaporehomerental.com
vistapersonalinjurylawyers.com
housepainterservices.com
renocleaningservice.com
rentalapartmentsvancouver.com
rentalhampton.com
rentalhomeservices.com
estateattorneyschicago.com
evansvillebankruptcylawyers.com
eventsmanagementservice.com
flowersdeliverynearme.com
fordservicetruck.com
foundationrepairwinnipeg.com
framinghamdivorcelawyer.com
fremontcriminallawyers.com
fresnocriminaldefenselawyers.com
fuelstationsnearme.com
funeralservicesmiami.com
furnacerepairmannearme.com
furnacerepairsedmonton.com
gadgetnearme.com
garagedoorrepairedison.com
garagedoorrepairelpaso.com
garagedoorrepairmanteca.com
garagedoorrepairogdenutah.com
garagedoorrepairservicesnearme.com
garagedoorrepairsgeorgetown.com
garagedoorrepairsontario.com
garagedoorrepairssurrey.com
richmondtaxiservices.com
roofingrepairindianapolis.com
roofingservicesedinburgh.com
roofingservicestoronto.com
roomrentalsnearme.com
sacramentovanrentals.com
sarasotabusinesslawyer.com
schoolshuttleservices.com
evictionattorneynearme.com
evictionlawyersnearme.com
expungementattorneysnearme.com
expungementlawyernearme.com
fairmonttruckrental.com
familycourtattorneynearme.com
familycourtattorneysnearme.com
fathersrightsattorneyorlando.com
financiallawyernearme.com
financiallawyersnearme.com
fireextinguisherrepair.com
movingcompanyservice.com
mowinglawnservice.com
nevadarentalproperty.com
newnanpersonalinjurylawyer.com
newtondivorceattorney.com
niagarabikerentals.com
notarizeservices.com
nurseslawyer.com
nursinghomemalpracticeattorney.com
professionalproofreadingservices.com
professionalserviceproviders.com
propertiesmaintenanceservice.com
propertyinsuranceclaimslawyers.com
propertylawyersmelbourne.com
propertyrentalinsurance.com
propertyrentalmallorca.com
providencepersonalinjuryattorney.com
queensmalpracticelawyer.com
radiotaxiservice.com
railroadcrossinglawyer.com
raleighpropertyrentals.com
realestatelawyersottawa.com
reginafurnacerepair.com
rehabilitationclinicsnearme.com
reikiclassesnearme.com
relocationcompanynearme.com
oahurentalapartments.com
officecleanerservices.com
oklahomaexpungementlawyers.com
onlinefinanceservices.com
onlinerentalmovies.com
onlinetiffinservice.com
ontarioinsurancelawyers.com
ontariopersonalinjuryattorneys.com
organicfoodsnearme.com
orilliapersonalinjurylawyer.com
oshkoshdivorceattorney.com
oshkoshdivorceattorneys.com
ottawaluxuryrental.com
parentalcode.com
parentalmagazine.com
parklandpersonalinjurylawyer.com
partyboatsrental.com
louisianachildsupportlawyer.com
partyrentaldelaware.com
partyrentallubbock.com
pasadenafamilylawyers.com
patentlawyerphoenix.com
patriotrelocationservices.com
pediatricianmalpracticelawyer.com
peoriapersonalinjuryattorney.com
telemedicinenearme.com
tempeautoaccidentattorney.com
tenerifescooterrental.com
tennesseemesotheliomaattorneys.com
tennesseemesotheliomalawyers.com
torontobaillawyer.com
torrancedivorcelawyers.com
towingservicesnearby.com
trafficattorneymiami.com
trailerrepairshops.com
usedtruckforsalenearme.com
vacationrentalalabama.com
luxurycabservices.com
malpracticelawyerindianapolis.com
manhattanluxuryapartmentrentals.com
manicurepedicuresnearme.com
marylandmedicalmalpracticelawyers.com
marylandwrongfuldeathlawyers.com
massachusettslaborlawyer.com
massachusettsmotorcycleaccidentlawyer.com
massageservicedubai.com
mauitruckrentals.com
medicalmalpracticelawyerseattle.com
medicalmalpracticelawyersohio.com
medicalmalpracticeslawyer.com
medicalmisconductlawyers.com
mediccareservices.com
melbourneboatrentals.com
melbournecaraccidentlawyer.com
mesotheliomaattorneywashington.com
mesotheliomalawyerlouisiana.com
mesotheliomalawyerphiladelphia.com
mesotheliomalawyersvirginia.com
metaldetectorsrentals.com
miamipenthouserental.com
milwaukeetrafficlawyer.com
miramarpersonalinjuryattorney.com
mississaugaofficerental.com
mobilebarrentals.com
mobilerepairshops.com
motorcycleinjurylawyerflorida.com
moverscompanynearme.com
personalinjuryattorneychandler.com
personalinjuryattorneylexington.com
personalinjuryattorneyslawyers.com
personalinjuryattorneyspeoria.com
personalinjurylawyeraustintexas.com
personalinjurylawyerbradenton.com
personalinjurylawyerfullerton.com
personalinjurylawyergainesvilleflorida.com
personalinjurylawyerjacksonvilleflorida.com
personalinjurylawyerkelowna.com
personalinjurylawyermiamiflorida.com
personalinjurylawyerpensacolaflorida.com
personalinjurylawyersarasotaflorida.com
personalinjurylawyersscottsdale.com
personalinjurylawyertallahasseeflorida.com
smallbusinesslawyerpittsburgh.com
spainimmigrationlawyer.com
spartanburgpersonalinjurylawyers.com
specialboatservices.com
spokanemedicalmalpracticelawyer.com
stationeryshopnearme.com
workplaceabuselawyer.com
workplaceretaliationlawyers.com
wrongfuldeathslawyers.com
yorkpersonalinjurylawyers.com
personalinjurylawyertampaflorida.com
stripedclubnearme.com
studentadvisoryservice.com
swanseapersonalinjurylawyers.com
sydneyimmigrationlawyers.com
tallahasseerentalhomes.com
taxamnestylawyers.com
taxdebtrelieflawyer.com
personalinjuryprotectionlawyer.com
philadelphiacorporatelawyers.com
pittsburghchildcustodylawyer.com
plumbersservicenearme.com
plumbingservicetoronto.com
portlandfamilylawattorneys.com
postnuptialagreementlawyer.com
postnuptialagreementlawyers.com
pressurewashingcompanynearme.com
printingservicechicago.com
privateinvestigativeservice.com
professionalhomecareservices.com
rugcleaningottawa.com
safetysuppliesadelaide.com
salvagevehicleinsurance.com
bestelectricalsupplies.com
schaumburgcarpetcleaners.com
sewagetankcleaning.com
sheffieldcarpetcleaners.com
siliconesuppliers.com
sofadrycleaners.com
souvenirssupplier.com
spacleaningservices.com
windowcleanerportsmouth.com
abbotsfordcarpetcleaners.com
airductcleaningtulsa.com
alpineairductcleaning.com
amsterdamsupplies.com
amusementparksupplies.com
andycleaners.com
antiquecarpetcleaning.com
bestindustrialvacuumcleaners.com
boilerrepairssheffield.com
boiseidahocarpetcleaning.com
cakessupplier.com
campsuppliers.com
carpetcleanerberkshire.com
mortgageinsurancetexas.com
motorinsurancedubai.com
movinginsuranceservices.com
naplesgaragedoorrepair.com
nashvilleappliancerepairs.com
newbabysupplies.com
wholesalehairsupplier.com
carpetcleaningservicechicago.com
carpetcleaningserviceshouston.com
carpetcleaningsupplier.com
carpetcleaningsuppliers.com
chattanoogarugcleaning.com
cheapvaninsurances.com
chicagofarmersinsurance.com
chihuahuasupplies.com
chilliwackguttercleaning.com
christianshealthinsurance.com
cincinnatidrycleaner.com
cleaningpanda.com
cleaningrock.com
cleaningservicesoshawa.com
cleaningsupplieskit.com
dundeecarpetcleaner.com
earscleaningkit.com
edibleinksupplies.com
emergencypuncturerepairkit.com
enginecleaningservice.com
estatecleaningservices.com
everettcarpetcleaner.com
frozenfruitsupplier.com
funeralexpensesinsurance.com
furniturecleaningtoronto.com
garagedoorrepairgloucester.com
garagedoorsrepairmiami.com
garbagecleaners.com
gardenfurnituresupplies.com
huntingoutdoorsupplies.com
industrialelectricsupplies.com
insuranceforfemales.com
norwalkcarpetcleaners.com
norwichguttercleaning.com
officecleanerhouston.com
weddingcakesuppliers.com
windowcleanerchelmsford.com
windowcleanersalbuquerque.com
windowcleanerslansing.com
insuranceformopeds.com
insurancepacket.com
 
Visit Epik
Visit nameinvestors.com
Visit Epik domain registrar

Latest resources

Forum statistics

Threads
521,129
Messages
1,927,804
Members
531,763
Latest member
wandanmellior
Top Bottom