• Welcome to DNForum.com - Domain Investor Forum, Free Domain Marketplace and a community for 45+ domain pros
    If you are new to domains and looking to buy, sell and learn about domains then you have come to the right place. DNForum is the oldest global domain name community on the internet and continues to grow every day. There are over 45,000 domainers on DNForum doing everything from buying domains, selling domains, using our free in-house built tools, learning about domains and discussing domains. Take a minute and Register.

Live Feed: .NET Domain Name Auctions

Our live domain auction feed offers an easy way to secure the perfect web address for your business. With a vast selection of listings, you'll find domains with SEO potential, brandability, and instant recognition.

Live 33,494 auctions 0 selected
Collections
Domain ▲ DL ▲ Current bid ▲ Bids ▲ Ends in ▲ Platform TSL ▲ RD ▲ LR ▲ REC ▲ RE WFAY ▲ DW ▲
danielkatz.net 10 $1.00 0 Oct 7, 12:08 – 1 #65,755,492 6 .com .dev .fr – 2
finelin.net 7 $1.00 0 Oct 7, 12:08 – – – 3 .cloud .com .net – 2
nugrants.net 8 $1.00 0 Oct 7, 12:08 – – – 5 .com .info .net – 2
redstaterally.net 13 $1.00 0 Oct 7, 12:08 – – – 1 .net – 3
friendlyworldserver.net 19 $1.00 0 Oct 7, 12:09 – 2 #92,556,576 4 .com .info .net – 3
graphxtechstudio.net 16 $1.00 0 Oct 7, 12:09 – – – 2 .com .net – 0
holisticmedicinedirectory.net 25 $1.00 0 Oct 7, 12:09 – 2 #94,045,624 2 .com .net – 3
sendsit.net 7 $1.00 0 Oct 7, 12:09 – – – 3 .com .net .top – 2
valleyservicesco.net 16 $1.00 0 Oct 7, 12:09 – – – 1 .com – 3
bluebloomboutique.net 17 $1.00 0 Oct 7, 12:10 – – – 1 .net – 3
hitsale.net 7 $1.00 0 Oct 7, 12:10 – 9 #4,477,225 11 .best .co.uk .com – 2
mirevolution.net 12 $1.00 0 Oct 7, 12:10 – 2 #73,592,336 2 .com .net – 2
plasticsurgeryprice.net 19 $1.00 0 Oct 7, 12:10 – – – 2 .com .net – 3
alspals.net 7 $1.00 0 Oct 7, 12:11 – – – 8 .co.uk .com .dog – 2
elvoria.net 7 $1.00 0 Oct 7, 12:11 – – – 33 .app .art .asia – 2
itdsolution.net 11 $1.00 0 Oct 7, 12:11 – – – 3 .com .net .tech – 2
nwhk.net 4 $1.00 0 Oct 7, 12:11 – – – 5 .com .net .org 2017 0
performextraining.net 17 $1.00 0 Oct 7, 12:11 – – – 5 .com .info .net – 3
vskout.net 6 $1.00 0 Oct 7, 12:11 – – – 6 .biz .club .com – 0
aayessenterprises.net 17 $1.00 0 Oct 7, 12:12 – – – 5 .com .info .net – 0
assfaultgypsy.net 13 $1.00 0 Oct 7, 12:12 – – – 6 .biz .com .info – 3
beaubozarth.net 11 $1.00 0 Oct 7, 12:12 – – – 2 .com .net – 4
fiberbonds.net 10 $1.00 0 Oct 7, 12:12 – 1 #45,315,883 2 .com .net – 2
hausofkonnor.net 12 $1.00 0 Oct 7, 12:12 – – – 4 .com .info .net – 4
manouuka.net 8 $1.00 0 Oct 7, 12:12 – – – 1 .net – 0
marketriskmanager.net 17 $1.00 0 Oct 7, 12:12 – – – 2 .com .net – 3
masteringdecks.net 14 $1.00 0 Oct 7, 12:12 – – – 1 .net – 2
sewtrendyaccessories.net 20 $1.00 0 Oct 7, 12:12 – – – 3 .com .net .org – 3
shapeminds.net 10 $1.00 0 Oct 7, 12:12 – – – 2 .com .net – 2
casavagroup.net 11 $1.00 0 Oct 7, 12:13 – – – 2 .com .net – 2
claudiospano.net 12 $1.00 0 Oct 7, 12:13 – – – 2 .com .net – 3
gemsandswines.net 13 $1.00 0 Oct 7, 12:13 – – – 3 .com .net .org – 3
optionshtx.net 10 $1.00 0 Oct 7, 12:13 – – – 2 .com .net – 0
overdorfinsurance.net 17 $1.00 0 Oct 7, 12:13 – – – 2 .com .net – 3
perfectpolymers.net 15 $1.00 0 Oct 7, 12:13 – – – 4 .co.uk .com .net – 2
quickglideiv.net 12 $1.00 0 Oct 7, 12:13 – – – 2 .com .net – 3
revor.net 5 $1.00 0 Oct 7, 12:13 – – – 20 .biz .cfd .cloud – 2
dermestetic.net 11 $1.00 0 Oct 7, 12:14 – – – 2 .com .net – 3
dtilegal.net 8 $1.00 0 Oct 7, 12:14 – – – 3 .com .net .org – 2
hearingaiders.net 13 $1.00 0 Oct 7, 12:14 – – – 4 .co.uk .com .net – 2
itattendant.net 11 $1.00 0 Oct 7, 12:14 – 1 #45,337,268 3 .com .net .org – 2
kheatingncooling.net 16 $1.00 0 Oct 7, 12:14 – 5 #42,590,822 2 .com .net – 0
libertycallale.net 14 $1.00 0 Oct 7, 12:14 – – – 2 .com .net – 3
machinesalaver.net 14 $1.00 0 Oct 7, 12:14 – – – 3 .com .fr .net – 3
nailsspainspire.net 15 $1.00 0 Oct 7, 12:14 – – – 2 .com .net – 3
alternativemedicinedirectory.net 28 $1.00 0 Oct 7, 12:15 – – – 3 .com .net .org – 3
libertycallbeer.net 15 $1.00 0 Oct 7, 12:15 – – – 2 .com .net – 3
marketfund.net 10 $1.00 0 Oct 7, 12:15 – – – 11 .biz .click .co.uk – 2
thebizdoctor.net 12 $1.00 0 Oct 7, 12:15 – – – 3 .com .net .org – 3
easyphotos.net 10 $1.00 0 Oct 7, 12:16 – – – 6 .co.uk .com .de – 2
glacierai.net 9 $1.00 0 Oct 7, 12:16 – – – 5 .com .net .org – 2
kinotapok.net 9 $1.00 0 Oct 7, 12:16 – – – 1 .net – 3
libertylawgroup.net 15 $1.00 0 Oct 7, 12:16 – – – 2 .com .net – 3
mobilewoundpro.net 14 $1.00 0 Oct 7, 12:16 – – – 5 .com .net .org – 3
sharonmarkley.net 13 $1.00 0 Oct 7, 12:16 – – – 4 .com .info .net – 3
sorrentocapital.net 15 $1.00 0 Oct 7, 12:16 – – – 2 .com .net – 2
thefeedbackhub.net 14 $1.00 0 Oct 7, 12:16 – 1 #100,699,785 5 .club .co.uk .com – 3
thesearchforintelligentlife.net 27 $1.00 0 Oct 7, 12:16 – – – 3 .com .net .org – 5
cypresscarclub.net 14 $1.00 0 Oct 7, 12:17 – – – 3 .com .net .org – 3
eldengele.net 9 $1.00 0 Oct 7, 12:17 – – – 4 .com .info .net – 3
homesforsaleincorpuschristitx.net 29 $1.00 0 Oct 7, 12:17 – – – 1 .net – 0
hopeihaza.net 9 $1.00 0 Oct 7, 12:17 – – – 3 .com .net .org – 0
magiccomfortcake.net 16 $1.00 0 Oct 7, 12:17 – – – 2 .com .net – 3
omanx.net 5 $1.00 0 Oct 7, 12:17 – – – 3 .com .net .org – 0
resonantsearch.net 14 $1.00 0 Oct 7, 12:17 – – – 9 .agency .com .info – 2
runcdfirst.net 10 $1.00 0 Oct 7, 12:17 – – – 2 .com .net – 3
chronophobe.net 11 $1.00 0 Oct 7, 12:18 – – – 3 .art .com .net – 3
southernsmokestl.net 16 $1.00 0 Oct 7, 12:18 – – – 4 .com .info .net – 3
txcollegeaccess.net 15 $1.00 0 Oct 7, 12:18 – – – 3 .com .net .org – 3
clickheremovethere.net 18 $1.00 0 Oct 7, 12:19 – – – 5 .com .info .net – 4
cptcare.net 7 $1.00 0 Oct 7, 12:19 – – – 2 .com .net – 2
dijitalkuyumcu.net 14 $1.00 0 Oct 7, 12:19 – – – 3 .com .net .org – 0
fanplugged.net 10 $1.00 0 Oct 7, 12:19 – – – 3 .com .net .org – 2
longbeachbreakers.net 17 $1.00 0 Oct 7, 12:19 – – – 3 .com .net .org – 3
mississippimagic.net 16 $1.00 0 Oct 7, 12:19 – – – 2 .com .net – 2
pennsylvaniansagainstfracking.net 29 $1.00 0 Oct 7, 12:19 – – – 4 .com .info .net – 4
raspadinhadoxuxa.net 16 $1.00 0 Oct 7, 12:19 – – – 5 .club .com .net – 0
reformamethod.net 13 $1.00 0 Oct 7, 12:19 – 1 #100,663,407 5 .com .net .org – 3
chebib.net 6 $1.00 0 Oct 7, 12:20 – – – 6 .co.uk .com .dev 2003 2
cyvanceforda.net 12 $1.00 0 Oct 7, 12:20 – – – 3 .com .net .org – 4
duomispa.net 8 $1.00 0 Oct 7, 12:20 – – – 2 .com .net – 2
geronimobank.net 12 $1.00 0 Oct 7, 12:20 – – – 2 .com .net – 2
jozmore.net 7 $1.00 0 Oct 7, 12:20 – 1 #119,467,606 1 .net – 0
manscompany.net 11 $1.00 0 Oct 7, 12:20 – – – 2 .com .net – 2
socalsafetyenvironmental.net 24 $1.00 0 Oct 7, 12:20 – 1 #110,963,719 4 .com .info .net – 4
alkattanmed.net 11 $1.00 0 Oct 7, 12:21 – – – 4 .com .info .net – 4
blackstoneprotectiveservices.net 28 $1.00 0 Oct 7, 12:21 – – – 3 .co.uk .com .net – 3
cineholic.net 9 $1.00 0 Oct 7, 12:21 – – – 3 .com .net .space – 3
givebackla.net 10 $1.00 0 Oct 7, 12:21 – – – 3 .com .net .org – 0
misfitmaskmakers.net 16 $1.00 0 Oct 7, 12:21 – – – 4 .com .info .net – 3
planviewer.net 10 $1.00 0 Oct 7, 12:21 – – – 6 .app .cloud .co.uk – 2
ameliaehrhardt.net 14 $1.00 0 Oct 7, 12:22 – 1 #52,708,282 2 .com .net – 2
bodyshopgranadahills.net 20 $1.00 0 Oct 7, 12:22 – – – 5 .com .net .org – 4
camillerogers.net 13 $1.00 0 Oct 7, 12:22 – – – 1 .net – 2
chiokewalker.net 12 $1.00 0 Oct 7, 12:22 – – – 4 .com .info .net – 3
dutchmerch.net 10 $1.00 0 Oct 7, 12:22 – – – 2 .com .net – 2
greenvalleydrainandseptic.net 25 $1.00 0 Oct 7, 12:22 – – – 4 .com .info .net – 5
iacarrera.net 9 $1.00 0 Oct 7, 12:22 – – – 4 .com .fun .net – 0
soundbriefs.net 11 $1.00 0 Oct 7, 12:22 – – – 4 .com .info .net – 2
veteransfreedomcenter.net 21 $1.00 0 Oct 7, 12:22 1 Linked from boydgaming.com 8 #18,246,850 3 .com .net .org – 3
4,501–4,600 of 33,494
Back
Top Bottom