• Welcome to DNForum.com - Domain Investor Forum, Free Domain Marketplace and a community for 45+ domain pros
    If you are new to domains and looking to buy, sell and learn about domains then you have come to the right place. DNForum is the oldest global domain name community on the internet and continues to grow every day. There are over 45,000 domainers on DNForum doing everything from buying domains, selling domains, using our free in-house built tools, learning about domains and discussing domains. Take a minute and Register.

Live Feed: .COM Domain Name Auctions

Our live domain auction feed offers an easy way to secure the perfect web address for your business. With a vast selection of listings, you'll find domains with SEO potential, brandability, and instant recognition.

Live 649,483 auctions 0 selected
Collections
Domain ▲ DL ▲ Current bid ▲ Bids ▲ Ends in ▲ Platform TSL ▲ RD ▲ LR ▲ REC ▲ RE WFAY ▲ DW ▲
ksenialebedeva.com 14 $15.00 0 Sep 27, 11:00 – – – 2 .co.uk .com 2019 0
ktrkradio.com 9 $15.00 0 Sep 27, 11:00 – – – 1 .com 2023 0
kturnerbp.com 9 $5.00 0 Sep 27, 11:00 – 7 #37,746,290 1 .com 2010 0
kucingkampus.com 12 $2.00 0 Sep 27, 11:00 – 1 #66,944,648 1 .com – 0
kundenpilot.com 11 $5.00 0 Sep 27, 11:00 – – – 4 .com .de .pro 2024 3
kungpaotahoe.com 12 $5.00 0 Sep 27, 11:00 – – – 1 .com – 3
kupi.us.com 4 $5.00 0 Sep 27, 11:00 – – – 50 .africa .app .bike 2013 0
kynsp.com 5 $5.00 0 Sep 27, 11:00 – 7 #61,025,520 2 .biz .com – 2
kyronlearningpodcast.com 20 $5.00 0 Sep 27, 11:00 – 1 #88,254,640 1 .com – 5
kzitiz.it.com 6 $5.00 0 Sep 27, 11:00 – – – 0 – 0
kzwatch.com 7 $5.00 0 Sep 27, 11:00 – – – 2 .com .space – 0
labraptors.com 10 $15.00 0 Sep 27, 11:00 – – – 1 .com 2025 2
labsllms.com 8 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
labsmacrosenses.com 15 $15.00 0 Sep 27, 11:00 – – – 1 .com – 3
lacasonagt.com 10 $5.00 0 Sep 27, 11:00 – – – 2 .com .net 2021 4
laceycustomdisigns.com 18 $5.00 0 Sep 27, 11:00 – – – 1 .com – 4
lagatonvum.com 10 $15.00 0 Sep 27, 11:00 – – – 1 .com – 3
lailaelmoshneb.com 14 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
l-a-marketing.com 13 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
lambangcap3thpt-phuyen.com 22 $15.00 0 Sep 27, 11:00 – 1 #67,114,843 1 .com – 0
lancebarana.com 11 $5.00 0 Sep 27, 11:00 – – – 1 .com – 3
landryallthingsproperty.com 23 $5.00 0 Sep 27, 11:00 – – – 1 .com – 4
lankasuperlions.com 15 $5.00 0 Sep 27, 11:00 – – – 1 .com – 3
latibot.com 7 $15.00 0 Sep 27, 11:00 – – – 1 .com 2023 2
laurakazan.com 10 $15.00 0 Sep 27, 11:00 – – – 1 .com 2001 2
lav-tr.com 6 $2.00 0 Sep 27, 11:00 – – – 1 .com 2025 0
lawfirm-harris-sliwoski.com 23 $5.00 0 Sep 27, 11:00 – – – 0 – 0
lawnsprinklersystemssimivalley.com 30 $5.00 0 Sep 27, 11:00 – – – 1 .com 2023 0
lcaccepted.com 10 $5.00 0 Sep 27, 11:00 – 4 #28,379,123 1 .com 2016 2
ldrnetwork.com 10 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
le668etienne.com 12 $15.00 0 Sep 27, 11:00 – – – 1 .com – 0
leafienza.com 9 $15.00 0 Sep 27, 11:00 – – – 1 .com – 0
leaguersl.com 9 $5.00 0 Sep 27, 11:00 – – – 1 .com 2024 2
leanlifeeplus.com 13 $2.00 0 Sep 27, 11:00 – – – 1 .com – 4
learnfluentaiconsulting.com 23 $15.00 0 Sep 27, 11:00 – – – 1 .com – 4
learninganxiety.com 15 $5.00 0 Sep 27, 11:00 – 2 #49,291,682 1 .com – 2
learntobuildanaiagent.com 21 $5.00 0 Sep 27, 11:00 – – – 1 .com – 5
lebeergarden.com 12 $15.00 0 Sep 27, 11:00 – 1 #67,354,174 1 .com 2021 3
legendaryinvestmentz.com 20 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
legendarypartnerz.com 17 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
legendaryventure.com 16 $5.00 0 Sep 27, 11:00 – – – 2 .com .store 2010 2
legendtourism.com 13 $15.00 0 Sep 27, 11:00 – – – 2 .com .org – 2
legfowl.com 7 $15.00 0 Sep 27, 11:00 – – – 1 .com – 2
lehmanngrooming.com 15 $15.00 0 Sep 27, 11:00 – – – 1 .com – 2
leister.ru.com 7 $5.00 0 Sep 27, 11:00 – – – 51 .academy .asia .biz 2016 1
lendifty.com 8 $5.00 0 Sep 27, 11:00 – – – 1 .com – 3
leo-slot888.com 11 $5.00 0 Sep 27, 11:00 – – – 2 .com .org – 0
lepetitninja.com 12 $15.00 0 Sep 27, 11:00 – – – 1 .com – 3
letempduninstant.com 16 $5.00 0 Sep 27, 11:00 – – – 1 .com – 4
letscalepilotai.com 15 $15.00 0 Sep 27, 11:00 – – – 1 .com – 4
lever3impact.com 12 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
leveragelegend.com 14 $15.00 0 Sep 27, 11:00 – – – 1 .com 2021 2
leviathanweb.com 12 $15.00 0 Sep 27, 11:00 – – – 2 .com .online – 2
lggil.com 5 $5.00 0 Sep 27, 11:00 – – – 1 .com – 2
liccardomusic.com 13 $5.00 0 Sep 27, 11:00 – 2 #65,155,393 1 .com 2009 0
licindog.com 8 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
lifelinebag.com 11 $5.00 0 Sep 27, 11:00 – 1 #88,282,952 1 .com – 2
liftyourfreequency.com 18 $15.00 0 Sep 27, 11:00 – – – 1 .com – 5
lightbomber.com 11 $5.00 0 Sep 27, 11:00 1 Linked from fourkitchens.com 2 #26,977,819 1 .com 2013 2
lightfa.com 7 $15.00 0 Sep 27, 11:00 – – – 2 .com .org.uk – 2
lim4dhebat.com 10 $5.00 0 Sep 27, 11:00 – 1 #118,349,687 1 .com – 0
limecannabisco.com 14 $15.00 0 Sep 27, 11:00 – 1 #67,608,097 1 .com 2021 3
limitlessprosperitygroup.com 24 $15.00 0 Sep 27, 11:00 – – – 6 .biz .co.uk .com – 3
lindinaparfums.com 14 $15.00 0 Sep 27, 11:00 – 1 #44,290,603 1 .com – 0
linenhavenhome.com 14 $15.00 0 Sep 27, 11:00 – – – 2 .com .shop 2024 3
link96slot.com 10 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
linseedsti.com 10 $15.00 0 Sep 27, 11:00 – – – 1 .com – 2
liricanellaria.com 14 $15.00 0 Sep 27, 11:00 – – – 1 .com – 0
lisportrental.com 13 $15.00 0 Sep 27, 11:00 – – – 1 .com – 3
liuzhoumotor.com 12 $15.00 0 Sep 27, 11:00 – 1 #88,291,753 0 – 0
livequietfaith.com 14 $15.00 0 Sep 27, 11:00 – – – 1 .com – 3
livinginyourcar.com 15 $5.00 0 Sep 27, 11:00 – – – 1 .com 2016 4
livolaunch.com 10 $5.00 0 Sep 27, 11:00 – 1 #44,314,929 1 .com 2025 0
lklubmalta.com 10 $15.00 0 Sep 27, 11:00 – – – 1 .com – 0
llmeasy.com 7 $15.00 0 Sep 27, 11:00 – – – 2 .com .xyz – 2
lmjkxf.com 6 $2.00 0 Sep 27, 11:00 – – – 1 .com – 0
lm-mont.com 7 $15.00 0 Sep 27, 11:00 – – – 1 .com – 0
lnw-365.com 7 $15.00 0 Sep 27, 11:00 – – – 6 .asia .com .net – 0
loaninmin.com 9 $5.00 0 Sep 27, 11:00 – – – 1 .com – 2
loansmerchant.com 13 $15.00 0 Sep 27, 11:00 – – – 1 .com – 2
loanstrategyst.com 14 $5.00 0 Sep 27, 11:00 – – – 1 .com – 3
loans-x.com 7 $5.00 0 Sep 27, 11:00 – – – 1 .com – 0
localeliteclub.com 14 $5.00 0 Sep 27, 11:00 – – – 1 .com – 3
locminas.com 8 $5.00 0 Sep 27, 11:00 – – – 1 .com – 2
logicalmastery.com 14 $5.00 0 Sep 27, 11:00 – – – 1 .com 2018 2
logintw.com 7 $5.00 0 Sep 27, 11:00 – – – 1 .com 2021 2
lolinusirx.it.com 10 $15.00 0 Sep 27, 11:00 – – – 0 – 0
longdaysapp.com 11 $15.00 0 Sep 27, 11:00 – – – 1 .com – 3
lookhowawesomeur.com 16 $5.00 0 Sep 27, 11:00 – – – 2 .com .org – 4
lookhowawesomeyouare.com 20 $5.00 0 Sep 27, 11:00 – – – 2 .com .org 2024 5
lorenquaviro.com 12 $15.00 0 Sep 27, 11:00 – – – 1 .com – 0
losangelesinjuryhelp.com 20 $31.00 5 Sep 27, 11:00 – 1 #68,582,121 1 .com 2009 4
loscerrillos.com 12 $5.00 0 Sep 27, 11:00 – – – 2 .com .shop 2002 2
louisianaseafoodsuppliers.com 25 $5.00 0 Sep 27, 11:00 – – – 1 .com – 3
lovespell-lottospell.com 20 $15.00 0 Sep 27, 11:00 – – – 1 .com – 0
lovewithoutbordersof.com 20 $15.00 0 Sep 27, 11:00 – – – 1 .com – 4
lovlygame.com 9 $15.00 0 Sep 27, 11:00 – – – 1 .com 2024 0
loweramazonfees.com 15 $15.00 0 Sep 27, 11:00 – – – 1 .com 2024 3
lowticketacquisition.com 20 $15.00 0 Sep 27, 11:00 – – – 1 .com – 3
lowticketformula.com 16 $15.00 0 Sep 27, 11:00 – – – 1 .com – 3
3,101–3,200 of 649,483
Back
Top Bottom