• Welcome to DNForum.com - Domain Investor Forum, Free Domain Marketplace and a community for 45+ domain pros
    If you are new to domains and looking to buy, sell and learn about domains then you have come to the right place. DNForum is the oldest global domain name community on the internet and continues to grow every day. There are over 45,000 domainers on DNForum doing everything from buying domains, selling domains, using our free in-house built tools, learning about domains and discussing domains. Take a minute and Register.

Live Feed: .COM Domain Name Auctions

Our live domain auction feed offers an easy way to secure the perfect web address for your business. With a vast selection of listings, you'll find domains with SEO potential, brandability, and instant recognition.

Live 650,197 auctions 0 selected
Collections
Domain ▲ DL ▲ Current bid ▲ Bids ▲ Ends in ▲ Platform TSL ▲ RD ▲ LR ▲ REC ▲ RE WFAY ▲ DW ▲
jverny.com 6 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
kyeshajennings.com 14 $1.00 0 Oct 5, 15:46 1 Linked from ncarts.org 1 #26,718,440 1 .com – 3
letsfitwithus.com 13 $1.00 0 Oct 5, 15:46 – – – 1 .com – 4
littletonfretworks.com 18 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
livingspringfamilypsychiatry.com 28 $1.00 0 Oct 5, 15:46 – 1 #44,303,968 1 .com – 4
livinlegacyfinancial.com 20 $1.00 0 Oct 5, 15:46 – 1 #44,310,518 1 .com – 4
livlipscosmetics.com 16 $1.00 0 Oct 5, 15:46 – 1 #44,312,984 1 .com – 3
micsandco.com 9 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
mikesveganjourney.com 17 $1.00 0 Oct 5, 15:46 – 1 #118,411,341 1 .com – 3
mintagencygroup.com 15 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
mittikaswad.com 11 $1.00 0 Oct 5, 15:46 – – – 1 .com – 4
mosaictilesny.com 13 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
mycustom31.com 10 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
nautilusbyprestige.com 18 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
neoclasicotropical.com 18 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
newbalancecorridas.com 18 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
ntsleuth.com 8 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
oasisinspects.com 13 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
oduetctin.com 9 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
onicesaintlouis.com 15 $1.00 0 Oct 5, 15:46 – – – 1 .com – 4
orhpublising.com 12 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
paintworkswellesley.com 19 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
panormios.com 9 $1.00 0 Oct 5, 15:46 – – – 2 .com .org – 3
pasadenaofficespacesforrent.com 27 $1.00 0 Oct 5, 15:46 – – – 1 .com – 5
petruccelli-eng.com 15 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
plantquench.com 11 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
platafinds.com 10 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
pokerqueenbee.com 13 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
pretty-art.com 10 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
pureplantnutrient.com 17 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
pussiness.com 9 $1.00 0 Oct 5, 15:46 – – – 1 .com – 1
raccontidiviaggioblog.com 21 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
resenhacafe.com 11 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
residencial15demayo.com 19 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
rivelleoutlet.com 13 $1.00 0 Oct 5, 15:46 – – – 2 .com .shop – 3
sabinemunshicommunications.com 26 $1.00 0 Oct 5, 15:46 – 3 #85,527,467 1 .com – 3
sacredrehabilitation.com 20 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
saitecgroupsrl.com 14 $1.00 0 Oct 5, 15:46 – – – 1 .com – 4
saraisboutiques.com 15 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
schwbss.com 7 $1.00 0 Oct 5, 15:46 – – – 3 .com .net .top – 0
sethhawkinsdesign.com 17 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
shadowwroughtgames.com 18 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
shoptwinset.com 11 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
siglashop.com 9 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
sippfarms.com 9 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
skrolaa.com 7 $1.00 0 Oct 5, 15:46 – 1 #63,910,470 1 .com – 3
spiritfilledmarketingsolutions.com 30 $1.00 0 Oct 5, 15:46 – – – 1 .com – 4
stelastravel.com 12 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
sullivans-corner.com 16 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
sweetcreekflyguides.com 19 $1.00 0 Oct 5, 15:46 – – – 1 .com – 4
tantricapphub.com 13 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
thaifoodtoworld.com 15 $1.00 0 Oct 5, 15:46 2 Linked from ku.ac.th, tci-thaijo.org 5 #15,055,492 1 .com – 4
theelementofage.com 15 $1.00 0 Oct 5, 15:46 – – – 1 .com – 4
thekcphotography.com 16 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
thesouthporthome.com 16 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
thistownservices.com 16 $1.00 0 Oct 5, 15:46 – – – 0 – 3
tinamusicaddict.com 15 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
uaedebtfreedom.com 14 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
vegadrfit.com 9 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
velouriaperfume.com 15 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
vrsafc.com 6 $1.00 0 Oct 5, 15:46 – 3 #40,193,221 1 .com – 2
wearweirdwell.com 13 $1.00 0 Oct 5, 15:46 – – – 1 .com – 3
webebizzmarketing.com 17 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
wiegforum.com 9 $1.00 0 Oct 5, 15:46 – – – 3 .com .net .org – 0
wyndole.com 7 $1.00 0 Oct 5, 15:46 – – – 1 .com – 2
yl0411.com 6 $1.00 0 Oct 5, 15:46 – – – 2 .com .top – 0
zafrance-tariq.com 14 $1.00 0 Oct 5, 15:46 – – – 1 .com – 0
zhou24.com 6 $1.00 0 Oct 5, 15:46 – 1 #44,810,906 1 .com – 0
1v26c0rs.com 8 $1.00 0 Oct 5, 15:47 – 4 #58,740,916 2 .com .org.de – 0
345w74.com 6 $1.00 0 Oct 5, 15:47 – 3 #21,115,716 1 .com – 0
acmeseptictankco.com 16 $1.00 0 Oct 5, 15:47 – – – 1 .com – 4
adhinataenergyindonesia.com 23 $1.00 0 Oct 5, 15:47 – – – 1 .com – 0
apesplusone.com 11 $1.00 0 Oct 5, 15:47 – – – 1 .com – 3
arnetpro.com 8 $1.00 0 Oct 5, 15:47 1 Linked from wikipedia.org 4 #1,017,993 1 .com – 3
artofulo.com 8 $1.00 0 Oct 5, 15:47 – – – 1 .com – 3
artsinmotionstudio.com 18 $1.00 0 Oct 5, 15:47 – – – 2 .com .org – 4
astronautcredit.com 15 $1.00 0 Oct 5, 15:47 – – – 1 .com – 2
aurorasurgerycenter.com 19 $1.00 0 Oct 5, 15:47 – – – 1 .com – 3
bba-grh.com 7 $1.00 0 Oct 5, 15:47 – 1 #43,496,729 1 .com – 0
bensenvilleraiders.com 18 $1.00 0 Oct 5, 15:47 – 2 #97,697,270 1 .com – 2
bigjoeswarrenpa.com 15 $1.00 0 Oct 5, 15:47 – – – 1 .com – 5
bluerossma.com 10 $1.00 0 Oct 5, 15:47 – – – 1 .com – 3
brokeamatuers.com 13 $1.00 0 Oct 5, 15:47 – 1 #43,510,071 1 .com – 4
campaigns-stageproperties.com 25 $1.00 0 Oct 5, 15:47 – – – 1 .com – 0
cannaquilt.com 10 $1.00 0 Oct 5, 15:47 – – – 1 .com – 2
carolinahighlandgames.com 21 $1.00 0 Oct 5, 15:47 – 3 #55,211,647 1 .com – 3
chendify.com 8 $1.00 0 Oct 5, 15:47 – – – 1 .com – 3
chercheurauthentique.com 20 $1.00 0 Oct 5, 15:47 1 Linked from ceric.ca 1 #26,253,208 1 .com – 0
coccha.com 6 $1.00 0 Oct 5, 15:47 – – – 1 .com 2011 2
coloreriasedefa-sikkens.com 23 $1.00 0 Oct 5, 15:47 – – – 1 .com – 0
control-or.com 10 $1.00 0 Oct 5, 15:47 – – – 1 .com – 0
createvault-crypto.com 18 $1.00 0 Oct 5, 15:47 – – – 1 .com – 0
crimsonpremiumgroup.com 19 $1.00 0 Oct 5, 15:47 – – – 1 .com – 3
csuiteceramicsshop.com 18 $1.00 0 Oct 5, 15:47 – – – 1 .com – 4
daveelmanvirtualcafe.com 20 $1.00 0 Oct 5, 15:47 – – – 1 .com – 4
ditcoin0.com 8 $1.00 0 Oct 5, 15:47 – – – 1 .com – 0
dougaliano.com 10 $1.00 0 Oct 5, 15:47 – – – 1 .com – 3
egypttawykmt.com 12 $1.00 0 Oct 5, 15:47 – – – 1 .com – 0
eldercaretakers.com 15 $1.00 0 Oct 5, 15:47 – – – 1 .com – 2
elpoderdereinventarte.com 21 $1.00 0 Oct 5, 15:47 – – – 1 .com – 5
399,801–399,900 of 650,197
Back
Top Bottom