• Welcome to DNForum.com - Domain Investor Forum, Free Domain Marketplace and a community for 45+ domain pros
    If you are new to domains and looking to buy, sell and learn about domains then you have come to the right place. DNForum is the oldest global domain name community on the internet and continues to grow every day. There are over 45,000 domainers on DNForum doing everything from buying domains, selling domains, using our free in-house built tools, learning about domains and discussing domains. Take a minute and Register.

Live Feed: .COM Domain Name Auctions

Our live domain auction feed offers an easy way to secure the perfect web address for your business. With a vast selection of listings, you'll find domains with SEO potential, brandability, and instant recognition.

Live 675,739 auctions 0 selected
Collections
Domain ▲ DL ▲ Current bid ▲ Bids ▲ Ends in ▲ Platform TSL ▲ RD ▲ LR ▲ REC ▲ RE WFAY ▲ DW ▲
cryptocentralstore.com 18 $15.00 0 Oct 11, 11:00 – 2 #76,507,441 1 .com – 3
cryptocomercios.com 15 $15.00 0 Oct 11, 11:00 – – – 2 .com .net – 4
cryptofuneral.com 13 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
cryptoglobalpr.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
cryptoinstantnews.com 17 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
crypto-onchain-fc.com 17 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cryptorelay.com 11 $15.00 1 Oct 11, 11:00 – – – 2 .com .xyz – 2
crypto-search.com 13 $15.00 0 Oct 11, 11:00 – – – 3 .com .de .net – 0
cryptosignalsascend.com 19 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
crysalorivent.com 13 $15.00 0 Oct 11, 11:00 – – – 1 .com – 4
crysarocapital.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
crysdelta-energy.com 16 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
crysflowlabs.com 12 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
crysforge-capital.com 17 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cryslunafinance.com 15 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cryssphere.com 10 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cryssyterealty.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
crystal-gear.com 12 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
crystalis-energy.com 16 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
crystaliveno.com 12 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
crystal-slots-ltd.com 17 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
crystal-tokens.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
crystal-veil.com 12 $15.00 0 Oct 11, 11:00 – – – 2 .com .shop – 0
crystalwavedigitaltechmarket.com 28 $15.00 0 Oct 11, 11:00 – 1 #43,696,817 1 .com – 5
crytharionex.com 12 $15.00 0 Oct 11, 11:00 – – – 2 .com .sbs – 4
crythonavelis.com 13 $15.00 0 Oct 11, 11:00 – – – 1 .com – 4
crythovaniel.com 12 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cryvanelios.com 11 $15.00 0 Oct 11, 11:00 – 1 #43,697,889 1 .com – 4
cs259.com 5 $15.00 0 Oct 11, 11:00 – – – 3 .com .net .shop – 0
cs393.com 5 $15.00 0 Oct 11, 11:00 – 1 #43,700,173 1 .com – 0
cs395.com 5 $15.00 0 Oct 11, 11:00 – 1 #43,700,174 2 .com .org – 0
cs396.com 5 $15.00 0 Oct 11, 11:00 – 1 #43,700,175 1 .com – 0
cs565.com 5 $15.00 0 Oct 11, 11:00 – 2 #42,850,782 1 .com 2018 0
csgovaultsol.com 12 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cs-juice.com 8 $15.00 0 Oct 11, 11:00 – 1 #43,698,950 1 .com – 0
csrdhq.com 6 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cssanimationspocketguide.com 24 $15.00 0 Oct 11, 11:00 1 Linked from creativebloq.com 7 #10,281,996 1 .com – 4
csvworks.com 8 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
csxapp.com 6 $15.00 0 Oct 11, 11:00 – – – 2 .com .vip – 0
csxtransportation.com 17 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
ctrlaltdeleted.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
ctrlplusc.com 9 $15.00 0 Oct 11, 11:00 – 1 #10,186,994 2 .co.uk .com – 3
ctsullivans.com 11 $15.00 0 Oct 11, 11:00 – – – 1 .com – 4
cuban-humidors.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cubebeer.com 8 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
cubioinvest.com 11 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
cucissubtr.com 10 $15.00 0 Oct 11, 11:00 – – – 1 .com – 4
cuckoo-living.com 13 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cucuvaya.com 8 $15.00 0 Oct 11, 11:00 – 1 #80,724,414 1 .com – 0
cuddletoddler.com 13 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
cuiratlas.com 9 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
cuisim.com 6 $15.00 0 Oct 11, 11:00 – – – 2 .com .org – 2
cultpfp.com 7 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
culturehits.com 11 $15.00 0 Oct 11, 11:00 – 1 #79,278,217 2 .co.uk .com – 2
cumming55plushome.com 17 $15.00 0 Oct 11, 11:00 – 1 #117,212,977 1 .com – 0
cumulusmktg.com 11 $2.00 0 Oct 11, 11:00 – – – 1 .com – 2
cunahaula.com 9 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
cunilaryindo.com 12 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cupang188.com 9 $2.00 0 Oct 11, 11:00 – – – 3 .com .net .org – 0
cupcakeriapapas.com 15 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
cupeuro.com 7 $15.00 0 Oct 11, 11:00 – – – 1 .com 2008 2
curateaudio.com 11 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
curatedlooks.com 12 $15.00 0 Oct 11, 11:00 – – – 3 .club .com .shop – 3
curbsidelnfusion.com 16 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
curioconsortium.com 15 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
curioengineering.com 16 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
curionaxevio.com 12 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
curioposter.com 11 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
curious-quasar.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
currencypulseanalysistool.com 25 $15.00 0 Oct 11, 11:00 – – – 1 .com – 4
cursormode.com 10 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
curvoria.com 8 $15.00 0 Oct 11, 11:00 – – – 2 .com .store – 0
curvypetal.com 10 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
cusdin.com 6 $15.00 0 Oct 11, 11:00 – – – 3 .co.uk .com .de – 0
customartwallpaper.com 18 $2.00 0 Oct 11, 11:00 – – – 1 .com 2024 3
customcastillo.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
custom-closetgeeks.com 18 $15.00 0 Oct 11, 11:00 – – – 1 .com 2024 0
custom-conceptsbycynthia.com 24 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
custom-constructiondesigns.com 26 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
custom-constructionservices.com 27 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
customhotseals.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
customhousepainting.com 19 $15.00 0 Oct 11, 11:00 – – – 1 .com 2003 2
customizeoil.com 12 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
custom-newporttours.com 19 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cutekoalas.com 10 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
cutepinkcar.com 11 $15.00 0 Oct 11, 11:00 – 1 #87,808,282 1 .com – 3
cutflowerstand.com 14 $15.00 0 Oct 11, 11:00 – 1 #43,714,096 1 .com – 3
cv03c.com 5 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cvahealthleads.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
cvbyucsycmhykc.com 14 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cvintelplatform.com 15 $15.00 0 Oct 11, 11:00 – – – 1 .com – 3
cvutility.com 9 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
cwbrealtty.com 10 $15.00 0 Oct 11, 11:00 – – – 0 – 0
cwingscargo.com 11 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cwplo.com 5 $15.00 0 Oct 11, 11:00 – – – 1 .com – 2
cwwestgate.com 10 $15.00 0 Oct 11, 11:00 – – – 0 – 3
cxc32.com 5 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cxzxa01.com 7 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cyberaisolutionsbyyaz.com 21 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
cyberlab360.com 11 $15.00 0 Oct 11, 11:00 – – – 1 .com – 0
638,801–638,900 of 675,739
Back
Top Bottom